- SLC22A23 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91154
- C6orf85
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- SLC22A23
- 0.1 ml (also 25ul)
- Rabbit
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: PESRDQNLPE NISNGEHYTR QPLLPHKKGE QPLLLTNAEL KDYSGLHDAA AAGDTLPEGA TANGMKAM
- Human
- solute carrier family 22 member 23
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PESRDQNLPENISNGEHYTRQPLLPHKKGEQPLLLTNAELKDYSGLHDAAAAGDTLPEGATANGMKAM
Specifications/Features
Available conjugates: Unconjugated